PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076954.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 245aa    MW: 26900.9 Da    PI: 9.8798
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076954.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.61.4e-171050242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i n+s r+ tf kR++g++KK +ELS+LC+++++ +++s+
  XP_011076954.1 10 FITNDSARKATFKKRKKGLMKKVSELSTLCGIDACAVVYSP 50
                    89**************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554555.49E-24185IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-24160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.694149IPR002100Transcription factor, MADS-box
CDDcd002662.10E-21285No hitNo description
PRINTSPR004042.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-191051IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MTRKKVKLAF ITNDSARKAT FKKRKKGLMK KVSELSTLCG IDACAVVYSP YDSQPEVWPD  60
GRGAHRVLAQ FKRMPEMEQS KKMVNQESFI RHRISKAADQ LKKLHKDNRE KEITHLMYQC  120
LTGKGLQGLG AAELNDMGWL LDQNLKEIYK RIEGLKKKAV EAPGNGVEEK PAPLVLDGGM  180
QRAAPPQQWF TECMGNPGDN QQGLGSSFGH GGVGGSGSGG GGEEMILPFS DGSNSAAMWS  240
NVFFP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFITNDSARKATFKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076954.10.0PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK32e-59AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A022PV321e-116A0A022PV32_ERYGU; Uncharacterized protein
STRINGVIT_14s0060g00300.t016e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15322367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-60AGAMOUS-like 80